Transcript | Ll_transcript_416579 |
---|---|
CDS coordinates | 45-686 (+) |
Peptide sequence | MMALHKTYPFLHHSRFRCMLHQIPLSPSLTSLLSATTTSSSSLHGAVSSAITHVAVTALAIASGACLSTKLDFLWPKLDQQPGTIIQDGVDVTGYPIFNDAKVHKAIAFARKAHRGQMRKTGDPYLTHCIHTGRILAMLVPSSGKRAVDTVVAGILHDVVDDTCQSLQDIEEEFGDDVVNLVAGVSRLSYINQVCFFIFKEVAHYGLPYLVSC* |
ORF Type | complete |
Blastp | Probable GTP diphosphokinase RSH3, chloroplastic from Arabidopsis with 49% of identity |
---|---|
Blastx | Probable GTP diphosphokinase RSH3, chloroplastic from Arabidopsis with 49% of identity |
Eggnog | In eubacteria ppGpp (guanosine 3'-diphosphate 5-' diphosphate) is a mediator of the stringent response that coordinates a variety of cellular activities in response to changes in nutritional abundance (By similarity)(COG0317) |
Kegg | Link to kegg annotations (AT1G54130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423473.1) |
Pfam | HD domain (PF13328.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer