Protein coding transcript 75867

• Transcript: Ll_transcript_415383
• CDS coordinates: 414-1040 (+)
• Peptide sequence: MPGITAYAAIYEVDSPKKGDYVFISAASGAVGQLVGQFAKLLGCYVVGSAGSQEKVDLLRNKLGFDDAFNYKEEPALDAALKRCFPNGIDLYFEQVGGKMLDAVLLNMKIHGRIIICGMISQYNISEPEPLKNIMQVAFKRLSIKGFTHRDHHHLYPKLLETVLPYIREKKIVYVEDIVEGIENGPEALVGLFSGRNFGKQIVAVAHE*
• ORF Type: complete

Annotations of Ll_transcript_415383

• Blastp: NADP-dependent alkenal double bond reductase P2 from Arabidopsis with 68.27% of identity
• Blastx: 2-alkenal reductase (NADP(+)-dependent) from Nicotiana with 66.79% of identity
• Eggnog: alcohol dehydrogenase(COG2130)
• Kegg: Link to kegg annotations (AT5G16990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421610.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;