Protein coding transcript 7594

• Transcript: Ll_transcript_494883
• CDS coordinates: 168-470 (+)
• Peptide sequence: MQEDKKMKVKKGWLAVEVGLEDDQFQRFVIPISYLYHPLFKHLLDKAYEVYGYHTNGPLKLPCSIDEFLHLRWRIEKENGHHQHNHNHHRLPHVLYFHSC*
• ORF Type: complete

Annotations of Ll_transcript_494883

• Blastp: Auxin-responsive protein SAUR32 from Arabidopsis with 38.2% of identity
• Blastx: Auxin-induced protein 6B from Soja with 48.15% of identity
• Eggnog: Auxin-induced protein(ENOG410YXA2)
• Kegg: Link to kegg annotations (AT2G46690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017421346.1)
• Pfam: Auxin responsive protein (PF02519.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;