Protein coding transcript 75952

• Transcript: Ll_transcript_415682
• CDS coordinates: 348-740 (+)
• Peptide sequence: MQDAKICFCDDTLPDGYSVNKGDMVSYQPYAMGRMKFIWGDDAEEYRPERWLDENGIFQQQSPFKFTAFQAGPRLCLGKEFAYRQMKIFSAVLIGCFSFKLNDETKSVNYKTMINLHIDGGLEVKAFHRD*
• ORF Type: complete

Annotations of Ll_transcript_415682

• Blastp: Cytochrome P450 704C1 from Pinus with 57.03% of identity
• Blastx: Cytochrome P450 704C1 from Pinus with 57.03% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433532.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: 5S_rRNA (RF00001)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;