Transcript | Ll_transcript_415686 |
---|---|
CDS coordinates | 230-574 (+) |
Peptide sequence | MGFVSNPYFFSILCAALGLLFIQIVLKKLSKSDRKKYHPVAGTVFNQLMNFKRLHHYMTHLAGKYKTYRLISPFRNEIYTADPINVEYILKTNFENYGKVLFFTFTFIFLGVIL* |
ORF Type | complete |
Blastp | Cytochrome P450 704C1 from Pinus with 53.52% of identity |
---|---|
Blastx | Cytochrome P450 704C1 from Pinus with 53.52% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433532.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer