Protein coding transcript 75957

• Transcript: Ll_transcript_415688
• CDS coordinates: 1871-2497 (+)
• Peptide sequence: MKSTLDSIFQVAFGTELDSMCGSNEEGNKFADAFDTSSALTLYRYVDVFWKIKKFLNIGSEAILRKKTKILNEFVLKLINTRTTQQMKISKDDSVRKGGDILSRFLQVKDFDSTYLRDIILNFVIAGKDTTAATLAWFIYMLCKYPAVQEKAAEEVKQATNTTTVSSCAEFVSTVTEEALEKMNYLHAAITETLRLYPAVPVSELKHQ*
• ORF Type: complete

Annotations of Ll_transcript_415688

• Blastp: Cytochrome P450 704C1 from Pinus with 45.41% of identity
• Blastx: Cytochrome P450 704C1 from Pinus with 46.15% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433532.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;