Protein coding transcript 75990

• Transcript: Ll_transcript_414230
• CDS coordinates: 308-985 (+)
• Peptide sequence: MQLRKNQTLTRFHEFLKLQSEIGNITRQEAVSMVPPLFLDIRSNHLVLDMCAAPGSKTFQLLEIIHKSTETGSLPEGMVIANDLDIQRCNLLIHQAKRLCTSNLIVTNHEAQNFPGCFLNRNYDAMEPDQSIDQLLFDRVLCDVPCSGDGTLRKAPELWRKWNTGTGNGLHNLQVLIAIRGLSLLKVGGRMVYSTCSMNPIENEAVVAEFRNIKAQLVDVDREHVF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_414230

• Blastp: Multisite-specific tRNA:(cytosine-C(5))-methyltransferase from Saccharomyces with 55.56% of identity
• Blastx: tRNA (cytosine(34)-C(5))-methyltransferase from Gallus with 48.72% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YBL024W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437635.1)
• Pfam: 16S rRNA methyltransferase RsmB/F (PF01189.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;