Protein coding transcript 75991

• Transcript: Ll_transcript_414241
• CDS coordinates: 53-1210 (+)
• Peptide sequence: MNPIENEAVVAEVLRRCGGSVELVDVSSELPQLIRRPGLKSWKVHDKGTWLVSCKDVPKYRRSVILPGMFPAGGSYQELVDNSNCNADMGDNIGVCTNGNSEDGVQTVEEPLTHQAAEEVCDFPLEHCMRIVPHDQNTGAFFIAVLLKVAPLPATQEKSKTEIVEQNVEPLNLSLEDARALQINSSEGVLEEVSKAVPEEILNDTEQNTEDLEVSPVEEQDSKETEEPPIVENMAKKVPSKRKLQIQGRWRGVDPVVFFKDEAIINSIRAFYGIGEHFPLDGHLVTRNSDASHVKRIYYVSKSVKDVLKLNFSVGQQLKITSVGLKMFVSIFYSQLGENFIFIVIYLFICLISLSPVLLFLNKSNEHICNSDCTIRKGLRAVAGR*
• ORF Type: complete

Annotations of Ll_transcript_414241

• Blastp: tRNA (cytosine(34)-C(5))-methyltransferase from Gallus with 29.81% of identity
• Blastx: tRNA (cytosine(34)-C(5))-methyltransferase from Gallus with 29.81% of identity
• Eggnog: nOP2 Sun(COG0144)
• Kegg: Link to kegg annotations (420938)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464114.1)
• Pfam: 16S rRNA methyltransferase RsmB/F (PF01189.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;