Transcript | Ll_transcript_451632 |
---|---|
CDS coordinates | 116-1090 (+) |
Peptide sequence | MESENQKLLQSYPYFWGYTPEQDYYTQQGITSSKSHFTTPRGLTLFTRSWLPQTTPPRGIIFMVHGYGNDISWTFQSTSIFFAQMGFACFALDLQGHGHSQGLKAFVPNVDHVVHDCFSFFTHIRQSNTIFMGLPCFLYGESMGAAISLLIHFADPQGFKGAILVAPMCKISDKVRPRWPIPQILTFLAKFFPTLAIVPTPDLMYKSVKVDHKKVIADMNPMRYRGKPRLGTVVELLRVTDLLNKKLCDVSVPFIVLHGSADVVTDPEVSLELYEKARSEDKTIKVYDGMMHSLLFGETDENVQIVRNDILSWLNDRCNGRTVE* |
ORF Type | complete |
Blastp | Caffeoylshikimate esterase from Arabidopsis with 41.83% of identity |
---|---|
Blastx | Caffeoylshikimate esterase from Arabidopsis with 42.11% of identity |
Eggnog | alpha beta hydrolase fold(COG2267) |
Kegg | Link to kegg annotations (AT1G52760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422567.1) |
Pfam | Serine aminopeptidase, S33 (PF12146.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer