Protein coding transcript 76014

• Transcript: Ll_transcript_416290
• CDS coordinates: 1535-2335 (+)
• Peptide sequence: MNTLIGKGKPHEAQAIFNSLTEEGHRPTLITYTTLVAALTRQKRFKSIPSLLSKVEENGMKPDSILFNAIINAFSDSGKVDEAMKIFQKMKEYGCKPTTSTFNTLIKGFGLAGRPYESMKLLEMMGQEEKVKPNERTYNILIQAFCTTKKLEETWSILHKMVASGLRPDVVTYNTLARAYAQNGETEKAERLILKMQYNKLKPNERTCGIIISGYCKERNMTDALRFLYKMKELGVHPNPVVFNSLIKGYLDTTDTDGVDEVSSNT*
• ORF Type: complete

Annotations of Ll_transcript_416290

• Blastp: Pentatricopeptide repeat-containing protein At5g21222 from Arabidopsis with 64.26% of identity
• Blastx: Pentatricopeptide repeat-containing protein At5g21222 from Arabidopsis with 63.83% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G21222)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446330.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;