Transcript | Ll_transcript_416078 |
---|---|
CDS coordinates | 152-463 (+) |
Peptide sequence | MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQVARRVWKDYYAKVHSLSVIILLLSSFLL* |
ORF Type | complete |
Blastp | GTP-binding protein SAR1B from Brassica with 91.58% of identity |
---|---|
Blastx | GTP-binding protein SAR1B from Brassica with 98.86% of identity |
Eggnog | Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. SAR1 controls the coat assembly in a stepwise manner. Activated SAR1-GTP binds to membranes first and recruits the SEC23 24 complex. These SEC23 24-SAR1 prebudding intermediates are then collected by the SEC13 31 complex as subunits polymerize to form coated transport vesicles. Conversion to SAR1-GDP triggers coat release and recycles COPII subunits (By similarity)(ENOG410YIKI) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_015959563.1) |
Pfam | ADP-ribosylation factor family (PF00025.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer