Protein coding transcript 76070

• Transcript: Ll_transcript_414456
• CDS coordinates: 3083-3445 (+)
• Peptide sequence: MFFITVKYTPQYTWLKEELTRVDREKTPWLIVLMHVPLYNSNEAHYMEGESMRSVFESWFIHYKVDVIFAGHVHAYERSYRFSNTDYNITSGHRFPIADKSAPVYITVGDGGNQEGLASR*
• ORF Type: complete

Annotations of Ll_transcript_414456

• Blastp: Phosphoenolpyruvate phosphatase from Allium with 85.22% of identity
• Blastx: Bifunctional purple acid phosphatase 26 from Arabidopsis with 75.56% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440753.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;