Protein coding transcript 76085

• Transcript: Ll_transcript_415464
• CDS coordinates: 201-689 (+)
• Peptide sequence: MMREVFRRLGSVRRYAKQSLRIDGVKHTIAVASGKGGVGKSTTAVNLAVSLATKCKLKVGLLDADVYGPNIPIMMNINTKPSVNLDMKMIPVENYGIKCMSIGFLVEKDAPIVWRGPMVSNALEKMTRGVNWGNLDILVMDMPPGTGDVQIAMSQKLQLSGS*
• ORF Type: complete

Annotations of Ll_transcript_415464

• Blastp: Iron-sulfur protein NUBPL from Dictyostelium with 55.26% of identity
• Blastx: Iron-sulfur protein NUBPL from Dictyostelium with 55.26% of identity
• Eggnog: ATP-binding protein(COG0489)
• Kegg: Link to kegg annotations (DDB_G0291193)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428626.1)
• Pfam: NUBPL iron-transfer P-loop NTPase (PF10609.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;