Protein coding transcript 761

• Transcript: Ll_transcript_468639
• CDS coordinates: 1-402 (+)
• Peptide sequence: LVYCFIFSPWSYHNGGYWPTLLWQFTLACIKMGRIELAEKAVALAEKRLPVDSWPEYYDTHTGKFIGKQSRLYQTWTISGFLTSKMLLKNTEKASLLFWEEDYELLEICVCSLNKSGRKKCSRGAAKSQILVP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_468639

• Blastp: Probable alkaline/neutral invertase A, chloroplastic from Arabidopsis with 83.2% of identity
• Blastx: Probable alkaline/neutral invertase A, chloroplastic from Arabidopsis with 83.2% of identity
• Eggnog: glycopeptide alpha-N-acetylgalactosaminidase activity(ENOG410XPYN)
• Kegg: Link to kegg annotations (AT3G05820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452283.1)
• Pfam: Alkaline and neutral invertase (PF12899.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;