Protein coding transcript 76102

• Transcript: Ll_transcript_414213
• CDS coordinates: 184-849 (+)
• Peptide sequence: MAAFSSLLRRLYLTAYNWIVFVGWVQVLYHVLNTLKESGHENVYNAAQKPLLFAQTAAVLEILHGLVGLVRSPVSATLPQIGSRLYLTWGILWSFPETQSHVLVSSLLISWSITEIIRYSFFGFKEAFGFAPSWLLWLRYSTFLLLYPTGISSEVGLIYIALPFIKASENYCVRMPNTWNFSFDYFYAAIVVLGIYVPGSPHMYRYMLAQRKKALSKSKRE*
• ORF Type: complete

Annotations of Ll_transcript_414213

• Blastp: Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2 from Arabidopsis with 80.54% of identity
• Blastx: Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2 from Arabidopsis with 80.54% of identity
• Eggnog: Protein tyrosine phosphatase-like(COG5198)
• Kegg: Link to kegg annotations (AT5G10480)
• CantataDB: Link to cantataDB annotations (CNT0002686)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445392.1)
• Pfam: Protein tyrosine phosphatase-like protein, PTPLA (PF04387.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;