Transcript | Ll_transcript_414215 |
---|---|
CDS coordinates | 184-720 (+) |
Peptide sequence | MAAFSSLLRRLYLTAYNWIVFVGWVQVLYHVLNTLKESGHENVYNAAQKPLLFAQTAAVLEILHGLVGLVRSPVSATLPQIGSRLYLTWGILWSFPETQSHVLVSSLLISWSITEIIRYSFFGFKEAFGFAPSWLLWLRYSTFLLLYPTGISSEVGLIYIALPFIKVKNQIWKCVQCF* |
ORF Type | complete |
Blastp | Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A from Oryza sativa with 78.82% of identity |
---|---|
Blastx | Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A from Oryza sativa with 78.82% of identity |
Eggnog | Protein tyrosine phosphatase-like(COG5198) |
Kegg | Link to kegg annotations (4335343) |
CantataDB | Link to cantataDB annotations (CNT0002686) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445392.1) |
Pfam | Protein tyrosine phosphatase-like protein, PTPLA (PF04387.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer