Protein coding transcript 76201

• Transcript: Ll_transcript_416404
• CDS coordinates: 950-1480 (+)
• Peptide sequence: MVAVFVVKGRLVCCTKMSLKSILQELKEIRGGIGSISKRGAQSKPWPSRTKSYIVPDVTVAPLEPIPQGPWANLPPELLLDIIRRVEESETSWPSRTVIVSCASVCKSWRVVTKETVKTPEQCGRLTFPISLKQPGPRDSPIQCFIRRNRETSTFLLYFGLVPCKFLSLLTIGVNL*
• ORF Type: complete

Annotations of Ll_transcript_416404

• Blastp: Tubby-like F-box protein 2 from Arabidopsis with 67.11% of identity
• Blastx: Tubby-like F-box protein 5 from Oryza sativa with 66.43% of identity
• Eggnog: tubby like protein(ENOG410XQFT)
• Kegg: Link to kegg annotations (AT2G18280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423785.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;