Protein coding transcript 76209

• Transcript: Ll_transcript_416018
• CDS coordinates: 326-640 (+)
• Peptide sequence: MYLFKSRFNHITCDVPIIWSMLSLVLSFVILVNMLLAATNTCVVEAGRQFKGGDHLGWHEPDPTNDIFYIQWAERNRFQVGDSLLFEYQNDSVLSVEKTYYLNCN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_416018

• Blastp: Early nodulin-like protein 1 from Arabidopsis with 36.25% of identity
• Blastx: Early nodulin-like protein 1 from Arabidopsis with 36.14% of identity
• Eggnog: Early nodulin-like protein(ENOG410YW92)
• Kegg: Link to kegg annotations (AT2G25060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457186.1)
• Pfam: Plastocyanin-like domain (PF02298.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;