Transcript | Ll_transcript_415518 |
---|---|
CDS coordinates | 322-654 (+) |
Peptide sequence | MGEAEKKDYVHSLESLANGLTWLFPERFLESDIGPEAVTTILGIIIAVNEHIIDTAPTQNNTGSTEKYLFPYPLCLSALKDLEMLVEVVSQHYYGDDKKWNFLAITEGTK* |
ORF Type | complete |
Blastp | Peroxisome biogenesis protein 16 from Arabidopsis with 53.77% of identity |
---|---|
Blastx | Peroxisome biogenesis protein 16 from Arabidopsis with 53.77% of identity |
Eggnog | Peroxisomal membrane protein(ENOG4111GEA) |
Kegg | Link to kegg annotations (AT2G45690) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431061.1) |
Pfam | Peroxisomal membrane protein (Pex16) (PF08610.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer