| Transcript | Ll_transcript_415506 |
|---|---|
| CDS coordinates | 2880-3266 (+) |
| Peptide sequence | MLQISKVTHITFFYLPTSPIKYCKFLLSFLFINFPPIMPMILKFLAYLSDQQLCAVTTILGIIIAVNEHIIDTAPTQNNTGSTEKYLFPYPLCLSALKDLEMLVEVVSQHYYGDDKKWNFLAITEGTK* |
| ORF Type | complete |
| Blastp | Putative ribonuclease H protein At1g65750 from Arabidopsis with 28.81% of identity |
|---|---|
| Blastx | Peroxisome biogenesis protein 16 from Arabidopsis with 41.67% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431061.1) |
| Pfam | zinc-binding in reverse transcriptase (PF13966.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer