Transcript | Ll_transcript_414600 |
---|---|
CDS coordinates | 369-1415 (+) |
Peptide sequence | MYSALIDGLCKDRLVVEALDLFSEMIGRGISPDVVSYNSLIHGLSVEGQLKEATRFLNEMRRKNISPTLRTFNIVIDALCKEGRVGEARDVFDMMAKMGYKPNVITYSALIDGYFLMKDVKKASWLFNNMDKNGVEPSVHTYNIMIDGYCKAKRLDDAMTLFKEMRNRNVVPDTVIYSSLIDGLCKSGKFSSAQNLVDEMHNSGQPVGLITYTILIDALCKSQDLDKAIELFMRIVNKGIRPDVCTYTVLIDGLCKGGRLKTAKEFFHHIVTKGCRLDVRTYYVMLNGLFKEGLFDEAMTLLSKMDDSGCPPDSITVEKVISTLLEKNEIEKVEKFLPEMKVKDPLNE* |
ORF Type | complete |
Blastp | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial from Arabidopsis with 39.3% of identity |
---|---|
Blastx | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial from Arabidopsis with 38.63% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT3G22470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450233.1) |
Pfam | PPR repeat (PF01535.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer