Protein coding transcript 76299

• Transcript: Ll_transcript_414606
• CDS coordinates: 369-1415 (+)
• Peptide sequence: MYSALIDGLCKDRLVVEALDLFSEMIGRGISPDVVSYNSLIHGLSVEGQLKEATRFLNEMRRKNISPTLRTFNIVIDALCKEGRVGEARDVFDMMAKMGYKPNVITYSALIDGYFLMKDVKKASWLFNNMDKNGVEPSVHTYNIMIDGYCKAKRLDDAMTLFKEMRNRNVVPDTVIYSSLIDGLCKSGKFSSAQNLVDEMHNSGQPVGLITYTILIDALCKSQDLDKAIELFMRIVNKGIRPDVCTYTVLIDGLCKGGRLKTAKEFFHHIVTKGCRLDVRTYYVMLNGLFKEGLFDEAMTLLSKMDDSGCPPDSITVEKVISTLLEKNEIEKVEKFLPEMKVKDPLNE*
• ORF Type: complete

Annotations of Ll_transcript_414606

• Blastp: Pentatricopeptide repeat-containing protein At3g22470, mitochondrial from Arabidopsis with 39.3% of identity
• Blastx: Pentatricopeptide repeat-containing protein At3g22470, mitochondrial from Arabidopsis with 38.63% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT3G22470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450233.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;