Protein coding transcript 76311

• Transcript: Ll_transcript_414743
• CDS coordinates: 52-1149 (+)
• Peptide sequence: MALLNPFSLYISISFFFFFSFSFSNAKDSSFSSPTTSSDVQLLLLKIKPLLQSNSDNLVLSSWNTSTPLCQWRGLKWVFTNASILSCTDLSSPQWTNLSLHNDPSLNLLSLQLPSANLSGSLPREIGEFPMLQSLYLNINSLKGTIPLELGYSTSLSDIDLSYNLFIGVLPPSIWNLCESDRLLSLKLHGNSLTGSVSEPALPNSTCKDLQFLDLGSNKFSGDFPEFVTKFGALKQLDLGDNMFVSTIPQSLAELRLEKLNLSHNNFSGVLPFFGESKFGVDAFEGNNPGLCGQPLKSCGGNNSSLSSGAVAGIVISLMTGAVVLASLLIGYMQNKKRKGSGESEDELNDDDDLDEEIDEENGGSG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_414743

• Blastp: Putative kinase-like protein TMKL1 from Arabidopsis with 67.17% of identity
• Blastx: Putative kinase-like protein TMKL1 from Arabidopsis with 70.33% of identity
• Eggnog: kinase-like protein(ENOG4111F3A)
• Kegg: Link to kegg annotations (AT3G24660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450203.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;