Protein coding transcript 76349

• Transcript: Ll_transcript_415297
• CDS coordinates: 1028-1684 (+)
• Peptide sequence: MGQLGHSSLQYGDKELLPRRVVSLDGIIIKDVACGGVHTCALTKEGALYAWGGGQSGQLGLGPESGLFSCVANDSRTFFRNIPVLTVPKDVKFVACGHSHTLISMQDGRIHGWGYNSYGQAANEKCTYAWYPSPVDCCVGEIRKLAAGGGHSAVLTDAHSLKELCEFVLADCMTSSNAAKIEDIASTTGSDALARLCGRIREYMVTGGDHEQNEVDKI*
• ORF Type: complete

Annotations of Ll_transcript_415297

• Blastp: Probable E3 ubiquitin-protein ligase HERC4 from Mus with 37.97% of identity
• Blastx: Probable E3 ubiquitin-protein ligase HERC4 from Mus with 37.72% of identity
• Eggnog: ubiquitin protein ligase(COG5021)
• Kegg: Link to kegg annotations (67345)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456541.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF00415.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;