Protein coding transcript 76355

• Transcript: Ll_transcript_415281
• CDS coordinates: 665-1279 (+)
• Peptide sequence: MDIDKILGTTKPASFPRKSAIYVWGYNQSGQTGRKGKQDQLRIPKQLPPELFGCPAGFNARWLDVACGREHTAAIASDGSLFTWGANDYGQLGDGTEERRKHPKKVKQLGSEFVKSVSCGAHCSACIAEPRDNDGTVSTGRLWVWGQNQGSNFPRLFWGAFEPNTVIHQVSCGAAHVVALSEAGLLQAWGESLIASLYFLSNVL*
• ORF Type: complete

Annotations of Ll_transcript_415281

• Blastp: RCC1 and BTB domain-containing protein 2 from Rattus with 30.17% of identity
• Blastx: RCC1 and BTB domain-containing protein 2 from Rattus with 30.17% of identity
• Eggnog: regulator of chromosome condensation(COG5184)
• Kegg: Link to kegg annotations (290363)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456545.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF00415.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;