Protein coding transcript 764

• Transcript: Ll_transcript_401518
• CDS coordinates: 1-573 (+)
• Peptide sequence: VFGVNLPSKRFVYAPTGPICPDYDDVRSFADAAKKGVSRALKAGIKSPLLVVPNYERFKQVELVTVLGALEELYVPIMVREDAPKKLEKPKTLGVFLEDKNRTSTTVKLANAIEAGRFVARDIGGGDPERMAPPRVEKYVTDVFGSGSGVKIEVLAGTQFFEKEYPLFAAVNRAASVIERHQGRIIFLTYE
• ORF Type: internal

Annotations of Ll_transcript_401518

• Blastp: Putative aminopeptidase W07G4.4 from Caenorhabditis with 44.62% of identity
• Blastx: Putative aminopeptidase W07G4.4 from Caenorhabditis with 44.62% of identity
• Eggnog: Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides (By similarity)(COG0260)
• Kegg: Link to kegg annotations (CELE_W07G4.4)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014490554.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;