Protein coding transcript 76445

• Transcript: Ll_transcript_414111
• CDS coordinates: 78-665 (+)
• Peptide sequence: MGLIPVTIIAGLCYAVVVLVGFPLSSNAELDPSFYKNTCSNVSSIVREVVRDVSKKDPRMLASLIRLHFHDCFVLGCDASVLLNNTDTPTKIESEQQAFPNNNSLRGLDVVNQIKTAVENACPGIVSCADILAIAARDAVFLSGGPSWDVPKGRKDGRKSKASETVQLPAPTFNISQLQKSFSQRGLSIEDLVALS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_414111

• Blastp: Peroxidase 64 from Arabidopsis with 56.04% of identity
• Blastx: Peroxidase 64 from Arabidopsis with 56.04% of identity
• Eggnog: peroxidase(ENOG410YE7F)
• Kegg: Link to kegg annotations (AT5G42180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431263.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;