Protein coding transcript 76499

• Transcript: Ll_transcript_415868
• CDS coordinates: 1732-2400 (+)
• Peptide sequence: MPWLAIPFSDSDTRNRLDELFDVKGIPHLVLLDESGKIVTDCGIEVIREYGVEGYPFSSERIQELNDHEIEAKKNQSLTSILSSHSRDFVISSDGKKILISDLEGKTIGLYFLLTADKECSDFTPQLVEIYAKLKAEGKEFEVVAVPLDDDDDDDDDNNDEEEEESFKAGVQSLPWLSLPFKDQSCEKLARYFELSALPTLVIVGPDGKTLHYNVVEFIEEYG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_415868

• Blastp: Probable nucleoredoxin 1 from Arabidopsis with 52.91% of identity
• Blastx: Probable nucleoredoxin 1 from Arabidopsis with 55.05% of identity
• Eggnog: nucleoredoxin-like(ENOG410ZIWC)
• Kegg: Link to kegg annotations (AT1G60420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439207.1)
• Pfam: Thioredoxin-like (PF13905.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;