Protein coding transcript 765

• Transcript: Ll_transcript_401531
• CDS coordinates: 1-360 (+)
• Peptide sequence: TIFALLQCTPDLSEQDCNNCLVASITDISSCCAGRINGRIGKPSCNLRFDTSPFYNSTVNTAQPPAPQVPPPPVTNTTSTQGKSNTTTIIVAVVVPVVSIAVLIILVCIFLRARKQWENI
• ORF Type: internal

Annotations of Ll_transcript_401531

• Blastp: Cysteine-rich receptor-like protein kinase 29 from Arabidopsis with 41.38% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 25 from Arabidopsis with 47.46% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G21410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427246.1)
• Pfam: Salt stress response/antifungal (PF01657.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;