Protein coding transcript 76505

• Transcript: Ll_transcript_415879
• CDS coordinates: 1432-1974 (+)
• Peptide sequence: MQIPVSDLEGKTIGLYFSLTPNKACIKFTPQLLEIYEKLKAEGEEFEVVMIPRDDGYEGEEEESFNEWFQTLPWLSLPFKDPSCEKLNWYFEYPAYPKLAIIGPDGKTLHYNVVEFIEEHGVDACPFTHQKIAELNEMQKAKDASQTLESILVSGDQDFVIGKDGVKVNFLNKLTTSSVE*
• ORF Type: complete

Annotations of Ll_transcript_415879

• Blastp: Probable nucleoredoxin 1 from Arabidopsis with 53.89% of identity
• Blastx: Probable nucleoredoxin 1 from Arabidopsis with 55.43% of identity
• Eggnog: nucleoredoxin-like(ENOG410ZIWC)
• Kegg: Link to kegg annotations (AT1G60420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423440.1)
• Pfam: Thioredoxin-like (PF13905.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;