Protein coding transcript 76536

• Transcript: Ll_transcript_415631
• CDS coordinates: 124-594 (+)
• Peptide sequence: MGTIFSPHTLSPLFNIKASTSKTLVSPQPNSNSKIYSKPIISCLKKNQTLSLKPSWPACTSWLTHAQHGLAALAISLALSFSPLLHTGNALASEFDVLNEGPPKESYVVDDAGVLSRLTKSDLKRLLSDLETRKNFHVNFITVRKLTVSYITMCLS*
• ORF Type: complete

Annotations of Ll_transcript_415631

• Blastp: UPF0603 protein At1g54780, chloroplastic from Arabidopsis with 56.46% of identity
• Blastx: UPF0603 protein At1g54780, chloroplastic from Arabidopsis with 55.78% of identity
• Eggnog: of methanol dehydrogenase type(COG1512)
• Kegg: Link to kegg annotations (AT1G54780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421308.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;