Protein coding transcript 76578

• Transcript: Ll_transcript_415315
• CDS coordinates: 3-431 (+)
• Peptide sequence: AFSARHAECEELNTEILGVSVDSVFSHLAWVQTDRKSGGLGDLKYPLISDITKSISKSYGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETKRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFAAV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_415315

• Blastp: 2-Cys peroxiredoxin BAS1-like, chloroplastic from Arabidopsis with 91.55% of identity
• Blastx: 2-Cys peroxiredoxin BAS1-like, chloroplastic from Arabidopsis with 91.55% of identity
• Eggnog: alkyl hydroperoxide reductase(COG0450)
• Kegg: Link to kegg annotations (AT5G06290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444263.1)
• Pfam: AhpC/TSA family (PF00578.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;