Transcript | Ll_transcript_415316 |
---|---|
CDS coordinates | 249-854 (+) |
Peptide sequence | MPSQSELPLVGNTAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFEELNTEILGVSVDSVFSHLAWVQTDRKSGGLGDLKYPLISDITKSISKSYGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETKRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFAAV* |
ORF Type | complete |
Blastp | 2-Cys peroxiredoxin BAS1-like, chloroplastic from Arabidopsis with 93.88% of identity |
---|---|
Blastx | 2-Cys peroxiredoxin BAS1-like, chloroplastic from Arabidopsis with 93.88% of identity |
Eggnog | alkyl hydroperoxide reductase(COG0450) |
Kegg | Link to kegg annotations (AT5G06290) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444226.1) |
Pfam | AhpC/TSA family (PF00578.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer