Protein coding transcript 76599

• Transcript: Ll_transcript_415401
• CDS coordinates: 2-340 (+)
• Peptide sequence: GELVEDGVPVCEGGSGSSEESDVGSDLYKNEDDKQRLAKMTELEREMILSDRAAKKGELVEDGVPVCEGGSGSSEESDVGSDLYKNEDDKQRLAKMTELEREMILSDRAAKKG
• ORF Type: internal

Annotations of Ll_transcript_415401

• Blastp: Protein RTF1 homolog from Arabidopsis with 52.33% of identity
• Blastx: Protein RTF1 homolog from Arabidopsis with 75% of identity
• Eggnog: Rtf1, Paf1 RNA polymerase II complex component, homolog (S. cerevisiae)(COG5296)
• Kegg: Link to kegg annotations (AT1G61040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015968228.2)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;