Protein coding transcript 76601

• Transcript: Ll_transcript_415412
• CDS coordinates: 413-2008 (+)
• Peptide sequence: MTELQREMILSDRAAKKDDKNLLGKIASKRDKGKAVAPRKQSPPMSSSRVRASARSADRSAKNVALNELRAKRLKQQDPEAHRRLREASKGSGARRFSPQKRKNFTSASLSSSSHSESESHSDDDGSTGDGGQDSDDDRTLAGSGGLSFQDIKEITIRRSKLGRWFMEPFFEELIVGCFVRVGIGRSKTGPIYRLCMVKNVDASEPDKRYIFENKNTYKYLNVVWGNESSSARWQMAMVSNSPPIEEEFKQWVNEVDRSGGRMPSKHEVLEKKQAIQKITTFVYSAATVKQMLQEKKSASSRPLNVAAEKDRLRREMEIAKSRNDEAGVRRIKKRLQELEASRQAQGKDVKALRLAEMNRKNRFENFKNASEMKRVNLDLKAGEAGYDPFSRRWTRSRNYYAAEPSEEAAAAKNSASSTVADSSSNGTGAVKAGEVATAEALEAAAGAGKLVDTSAPVDQGTESYLMHNFDLPISLSALQNFGGAQGVQAGFLANKQRIEATMGVRVPENDGKKHALTLSISDYKRRRGLL*
• ORF Type: complete

Annotations of Ll_transcript_415412

• Blastp: Protein RTF1 homolog from Arabidopsis with 62.06% of identity
• Blastx: Protein RTF1 homolog from Arabidopsis with 59.73% of identity
• Eggnog: Rtf1, Paf1 RNA polymerase II complex component, homolog (S. cerevisiae)(COG5296)
• Kegg: Link to kegg annotations (AT1G61040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445646.1)
• Pfam: Plus-3 domain (PF03126.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;