Transcript | Ll_transcript_415613 |
---|---|
CDS coordinates | 413-898 (+) |
Peptide sequence | MRVIPNKTSEAMPYEGRPLERPKIDAKQHLTEGGSSSQHEDVKGSSTNLRAKDVLDQSTGEGPTIDFSAIKPGLAADVKFGGGGSCPNLPWVSTTGSNGKTISGVTYRYSTNQIRIVCACHGSHMTPEEFVRHANDDQANPEDVAVFGAAANGNPAGSTHR* |
ORF Type | complete |
Blastp | Ninja-family protein mc410 from Nicotiana with 55.7% of identity |
---|---|
Blastx | Ninja-family protein mc410 from Nicotiana with 53.61% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (107806815) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423959.1) |
Pfam | TPL-binding domain in jasmonate signalling (PF16135.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer