| Transcript | Ll_transcript_414289 |
|---|---|
| CDS coordinates | 956-1264 (+) |
| Peptide sequence | MGTERVNLRRYEGLAKVGGTVISVSGAVAMVLYRGPALIGYTDNVHVAQNEVSARVHAEPPGRFISGLENLGLGHFHLGVICLIGNCICMAAYLAILVCIFC* |
| ORF Type | complete |
| Blastp | WAT1-related protein At4g19185 from Arabidopsis with 57.29% of identity |
|---|---|
| Blastx | WAT1-related protein At5g45370 from Arabidopsis with 57.42% of identity |
| Eggnog | Auxin-induced protein(ENOG4110YP2) |
| Kegg | Link to kegg annotations (AT4G19185) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422569.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer