Transcript | Ll_transcript_414274 |
---|---|
CDS coordinates | 841-1407 (+) |
Peptide sequence | MGTERVNLRRYEGLAKVGGTVISVSGAVAMVLYRGPALIGYTDNVHVAQNEVSARVHAEPPGRFISGLENLGLGHFHLGVICLIGNCICMAAYLAILAPVLKKYPANLSATAYSYFFGAILMATVSLFAANELNDWILTPTEVLAVFYSGIIASAVNYGLMTWCNRILGPTLVALFIPLQPGFASLLSQ |
ORF Type | 3prime_partial |
Blastp | WAT1-related protein At4g19185 from Arabidopsis with 59.26% of identity |
---|---|
Blastx | WAT1-related protein At4g19185 from Arabidopsis with 62.2% of identity |
Eggnog | Auxin-induced protein(ENOG4110YP2) |
Kegg | Link to kegg annotations (AT4G19185) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422569.1) |
Pfam | EamA-like transporter family (PF00892.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer