Protein coding transcript 76693

• Transcript: Ll_transcript_455173
• CDS coordinates: 172-612 (+)
• Peptide sequence: MMCSFLLQLCMVYRYSIKLVNSSLPFCSVFISSVEQSIYALLRTRDMAISRYKEFGIPVNWLLDSGDVGKIKLSSVQLAKKYMKRVASELDMLSGSNNEPTQQFLILQGVRFAFRVHQFAGGFDEESMKAFEELRRRINTQAGEDY*
• ORF Type: complete

Annotations of Ll_transcript_455173

• Blastp: Protein CHUP1, chloroplastic from Arabidopsis with 77.39% of identity
• Blastx: Protein CHUP1, chloroplastic from Arabidopsis with 77.39% of identity
• Eggnog: Chloroplast unusual positioning(ENOG4111F63)
• Kegg: Link to kegg annotations (AT3G25690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428907.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;