Protein coding transcript 76864

• Transcript: Ll_transcript_455726
• CDS coordinates: 328-666 (+)
• Peptide sequence: MKYSNALAAFMLLIFIVSTSEATLSCSDVIKDLKPCISYLVSGSGKPPAACCSGAKALASSAITSEDKKVACNCIKSSAKSITLNSQLAQALPGNCGISLSISISPNADCSK*
• ORF Type: complete

Annotations of Ll_transcript_455726

• Blastp: Non-specific lipid-transfer protein 8 from Arabidopsis with 52.83% of identity
• Blastx: Non-specific lipid-transfer protein 8 from Arabidopsis with 52.83% of identity
• Eggnog: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity)(ENOG41118KK)
• Kegg: Link to kegg annotations (AT2G18370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425387.1)
• Pfam: Probable lipid transfer (PF14368.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;