Protein coding transcript 7689

• Transcript: Ll_transcript_494747
• CDS coordinates: 95-451 (+)
• Peptide sequence: MKATEKSDVYSMGIVFMELVCGKMPTDAAFKGHMDMVRWVEMRIDMHGAARDELIDPELKPLLPAEEFAAFQVLEIAMQCTKTIPQERPSSRQVCDLLQHVLKNKKVDFEKMKLDHNK*
• ORF Type: complete

Annotations of Ll_transcript_494747

• Blastp: LRR receptor-like serine/threonine-protein kinase GSO1 from Arabidopsis with 68.75% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase GSO1 from Arabidopsis with 64.57% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G20140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439319.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;