| Transcript | Ll_transcript_454888 |
|---|---|
| CDS coordinates | 1-1179 (+) |
| Peptide sequence | PEAAAQSAATTTWGSGVTAVAFDPTCGGSVIAVVIVEGQYMSPYDPDEGPSITGWRVQRWESSLQQVVLHPIFGNPTSSMGGQPPMQTVWQSKVDLSIPPTNDFKNHPAPGVITDVQKVSVSSSDKSERVNFDPFDLPSDVRTLARVIYSAHGGEIAIAFLRGGVHIFSGPNFSPVDNYQINVGSAIAVPAFSSTSCCSASVWHDSSKDHTILKIIRVLPPAIPTSQVKANSSAWERAIAERFWWSLLVGVDWWDAVGCTQSAAEDGIVSLNSVIAVLDADFHSLPSSQHRLQYGPSLDRIKCRLLEGSNAQEVRAMVLDMQARLLLDMLGKGIESALINPSALVPEPWQASAEALNSIDSESMAIEPALVPTIQAYVDSVLDLASHFITRLR |
| ORF Type | internal |
| Blastp | Mediator of RNA polymerase II transcription subunit 16 from Arabidopsis with 81.27% of identity |
|---|---|
| Blastx | Mediator of RNA polymerase II transcription subunit 16 from Arabidopsis with 81.27% of identity |
| Eggnog | NA(ENOG410XS10) |
| Kegg | Link to kegg annotations (AT4G04920) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421369.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer