Protein coding transcript 76984

• Transcript: Ll_transcript_455125
• CDS coordinates: 193-882 (+)
• Peptide sequence: MFQALTIIAFNDGHINLDTIKTILSIGPSFAIMNFIKSCLDVLLTFGAYSTARGMAVSRLVIRFFWGGLTSAGVTYLYVKVLQERKSHNNLDYPIYFRIYILVLGVYAAIRLFFAFLLKFPACHALSDMSDQSFFQFFKWIYQERYFVGRGLYEKMSDYCSYVAYWLVILACKFTFAYFLQIRPLVKPTNIIVHLQSLTYAWHDIISKNNNNILTVVSLWAPVMAVSIL*
• ORF Type: complete

Annotations of Ll_transcript_455125

• Blastp: Callose synthase 10 from Arabidopsis with 67.69% of identity
• Blastx: Callose synthase 10 from Arabidopsis with 68.22% of identity
• Eggnog: synthase(ENOG410XQ8V)
• Kegg: Link to kegg annotations (AT2G36850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416881.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;