| Transcript | Ll_transcript_455148 |
|---|---|
| CDS coordinates | 2744-3136 (+) |
| Peptide sequence | MNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEESKSRTDRKPPGVGRGRGRGGSQDGPGGRPAKGIGRGVDEGGARGQGGSRGGRGGIGGKPGGNRGKSPPSLFQNSFTACMYTNC* |
| ORF Type | complete |
| Blastp | Probable U6 snRNA-associated Sm-like protein LSm4 from Nicotiana with 84.88% of identity |
|---|---|
| Blastx | DNA mismatch repair protein PMS1 from Arabidopsis with 72.5% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019441764.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer