Protein coding transcript 77032

• Transcript: Ll_transcript_455164
• CDS coordinates: 697-1314 (+)
• Peptide sequence: MKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLFRPLRMELSLEEEIVASMHMDIIRKNGFTLEEDPNAPPGCRYKLTSVPFSKNIMFGVEDVKELISTLSDEHGECSIIGSYKLDTSGSICPSRVRAMLASRACQSSTMVGDPLDRNEMQKIVEHLAELKSPWNCPHGRPTMRHLIDLTTIHKSSELTM*
• ORF Type: complete

Annotations of Ll_transcript_455164

• Blastp: DNA mismatch repair protein PMS1 from Arabidopsis with 72.92% of identity
• Blastx: DNA mismatch repair protein PMS1 from Arabidopsis with 63.51% of identity
• Eggnog: This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a molecular matchmaker , a protein that promotes the formation of a stable complex between two or more DNA-binding proteins in an ATP-dependent manner without itself being part of a final effector complex (By similarity)(COG0323)
• Kegg: Link to kegg annotations (AT4G02460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441764.1)
• Pfam: MutL C terminal dimerisation domain (PF08676.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;