Protein coding transcript 77132

• Transcript: Ll_transcript_454312
• CDS coordinates: 280-642 (+)
• Peptide sequence: MIDNVVLIVTGTLHERDVQELLEKCHPLGMFDSIATLAVAQNMRELYRLVLVDTPLAPYFSECITSEDLDDMNIEIMRNTLYKAYLEDFYRFCQVINLRLFPSPGFCVLSHFFGFTDFNVI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_454312

• Blastp: V-type proton ATPase subunit d1 from Arabidopsis with 93.81% of identity
• Blastx: V-type proton ATPase subunit d1 from Arabidopsis with 93.2% of identity
• Eggnog: ATP synthase, subunit(COG1527)
• Kegg: Link to kegg annotations (AT3G28710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013447528.1)
• Pfam: ATP synthase (C/AC39) subunit (PF01992.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;