Transcript | Ll_transcript_455598 |
---|---|
CDS coordinates | 3410-3736 (+) |
Peptide sequence | MEAAKVFKYSGREFGASVCFGFFAVSWLVLRLIFFPFWVIRATSIDLQKCLNLAETFPMFLYYTFNTLLIMLLIFHIYWWMLICAMINRQLKNRGKVGEDIRSDSDDD* |
ORF Type | complete |
Blastp | LAG1 longevity assurance homolog 2 from Arabidopsis with 71.3% of identity |
---|---|
Blastx | LAG1 longevity assurance homolog 2 from Arabidopsis with 74.8% of identity |
Eggnog | ceramide synthase(COG5058) |
Kegg | Link to kegg annotations (AT3G19260) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445784.1) |
Pfam | TLC domain (PF03798.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer