| Transcript | Ll_transcript_455600 |
|---|---|
| CDS coordinates | 88-435 (+) |
| Peptide sequence | MDSIWSNDDKPDAWHYSLAIYFAFACFFLRFILDRFVFRRLAIRMLIKGKTAPRITKEMQVKIGKCSESMWKLTYYATVELFILKIIYPEPWFSNTKLYFEDWPNHELKSPLKIYY |
| ORF Type | 3prime_partial |
| Blastp | - |
|---|---|
| Blastx | LAG1 longevity assurance homolog 2 from Arabidopsis with 45.53% of identity |
| Eggnog | ceramide synthase(COG5058) |
| Kegg | Link to kegg annotations (AT3G19260) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421413.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer