Transcript | Ll_transcript_455594 |
---|---|
CDS coordinates | 1387-1782 (+) |
Peptide sequence | MLIKGKTAPRITKEMQVKIGKCSESMWKLTYYATVELFILKIIYPEPWFSNTKLYFEDWPNHELKSPLKIYYMCECGFYIYSIAAILTWETRRKDFGVMFSHHVITVFLIGISYLTSFFRIGSIILALHDAS |
ORF Type | 3prime_partial |
Blastp | - |
---|---|
Blastx | LAG1 longevity assurance homolog 2 from Arabidopsis with 58.99% of identity |
Eggnog | ceramide synthase(COG5058) |
Kegg | Link to kegg annotations (AT3G19260) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421413.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer