Protein coding transcript 7716

• Transcript: Ll_transcript_494734
• CDS coordinates: 408-1073 (+)
• Peptide sequence: MPTKDTDHWTPDNTLNRHNTHLGTTFDPTSNTNIWPSNQNANEHQVTTPDANNVDNTESQTKGPNEINSPMRSLRNKRKPRYLQDYHCTLNSSSCHLEPLTCSQVRYPLSKSISYDQLSKNHRHFSLTISSANEPDTYHEAIKYECWQKAIQTEFSALDANQTWILTTLPKDSKAIGCKWVFKLKYKFYGTIEWHKARLVAKCFSQTEGVDNKTCYQNDHY*
• ORF Type: complete

Annotations of Ll_transcript_494734

• Blastp: Uncharacterized mitochondrial protein AtMg00820 from Arabidopsis with 44.21% of identity
• Blastx: Copia protein from Sophophora with 36.53% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp071)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432846.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF07727.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;